P2RY1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7706
Zusätzliche Namen:: P2RY1|P2Y1|SARCC
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL
Uniprot:: P47900
Synonyme:: ADP receptor;ATP receptor;P2 purinoceptor subtype Y1;P2Y purinoceptor 1;P2Y1;platelet ADP receptor;Purinergic receptor;purinergic receptor P2Y, G-protein coupled, 1;SARCC;suppressing androgen receptor in renal cell carcinoma
Weitere Details:: The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation.