INPP4A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7691
Zusätzliche Namen:: INPP4|INPP4A|TVAS1
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAVSVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMA
Uniprot:: Q96PE3
Synonyme:: Inositol polyphosphate 4-phosphatase type I;inositol polyphosphate-4-phosphatase type I A;inositol polyphosphate-4-phosphatase, type I, 107kD;inositol polyphosphate-4-phosphatase, type I, 107kDa;INPP4;TVAS1;type I inositol 3,4-bisphosphate 4-phosphatase
Weitere Details:: This gene encodes an Mg++ independent enzyme that hydrolyzes the 4-position phosphate from the inositol ring of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate, and inositol 3,4-bisphosphate. Multiple transcript variants encoding distinct isoforms have been described.