HBG2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7683
Zusätzliche Namen:: HBG-T1|HBG2|TNCY
Anwendung:: ELISA, WB
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVD
Uniprot:: P69892
Synonyme:: abnormal hemoglobin;G-gamma globin Paulinia;gamma globin;gamma-2-globin;gamma-globin chain;hb F Ggamma;HBG-T1;hemoglobin gamma-2 chain;hemoglobin gamma-G chain;hemoglobin subunit gamma-2;hemoglobin, gamma G;methemoglobin;TNCY
Weitere Details:: The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.