A7675
GH1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7675
- Zusätzliche Namen:
- GH|GH-N|GH1|GHB5|GHN|hGH-N|IGHD1A|IGHD1B|IGHD2
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVE
- Uniprot:
- P01241
- Synonyme:
- GH;GH-N;GHB5;GHN;Growth hormone;Growth hormone 1;growth hormone B5;hGH-N;IGHD1A;IGHD1B;IGHD2;pituitary growth hormone;somatotropin
- Weitere Details:
- The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
- Versandbedingungen:
- Blue Ice





