A7650
CD7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7650
- Zusätzliche Namen:
- CD7|GP40|LEU-9|Tp40|TP41
- Anwendung:
- ELISA, Flow Cytometry, WB
- Molekulargewicht:
- 38-40kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Uniprot:
- P09564
- Synonyme:
- CD7 antigen (p41);GP40;LEU-9;p41 protein;T-cell antigen CD7;T-cell leukemia antigen;T-cell surface antigen Leu-9;Tp40;TP41
- Weitere Details:
- This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
- Versandbedingungen:
- Blue Ice