YWHAZ Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7639
Zusätzliche Namen:: 14-3-3-zeta|HEL-S-3|HEL-S-93|HEL4|KCIP-1|POPCHAS|YWHAD|YWHAZ
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Uniprot:: P63104
Synonyme:: 14-3-3 delta;14-3-3 protein zeta/delta;14-3-3 protein/cytosolic phospholipase A2;14-3-3 zeta;14-3-3-zeta;epididymis luminal protein 4;epididymis secretory protein Li 3;epididymis secretory protein Li 93;HEL-S-3;HEL-S-93;HEL4;KCIP-1;phospholipase A2;POPCHAS;Protein kinase C inhibitor protein 1;protein kinase C inhibitor protein-1;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide;YWHAD
Weitere Details:: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

Versandbedingungen:: Blue Ice