Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7638
Zusätzliche Namen:: Thioredoxin 1 (Trx1/TXN)|TRDX|TRX|TRX1|Trx80
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Uniprot:: P10599
Synonyme:: ADF;ATL-derived factor;SASP;surface-associated sulphydryl protein;testicular tissue protein Li 199;thioredoxin;thioredoxin delta 3;TRDX;TRX;TRX1;Trx80;TXN delta 3
Weitere Details:: The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.