GLUT4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7637
Zusätzliche Namen:: GLUT4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FLLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Uniprot:: P14672
Synonyme:: glucose transporter type 4, insulin-responsive;GLUT-4;GLUT4;insulin-responsive glucose transporter type 4;solute carrier family 2 (facilitated glucose transporter), member 4;solute carrier family 2, facilitated glucose transporter member 4
Weitere Details:: This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).