A7590
C1GALT1C1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7590
- Zusätzliche Namen:
- C1GALT1C1|C1GALT2|C38H2-L1|COSMC|HSPC067|MST143|TNPS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLS
- Uniprot:
- Q96EU7
- Synonyme:
- beta 1,3-galactosyltransferase 2;C1GALT1-specific chaperone 1;C1GALT2;C38H2-L1;C38H2-like protein 1;core 1 beta1,3-galactosyltransferase 2;core 1 beta3-Gal-T2;core 1 beta3-galactosyltransferase-specific molecular chaperone;COSMC;HSPC067;MST143;TNPS;truncated C1GALT1-specific chaperone 1
- Weitere Details:
- This gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lacks the galactosyltransferase activity itself, but instead acts as a molecular chaperone required for the folding, stability and full activity of the core 1 beta1,3-galactosyltransferase 1. Mutations in this gene have been associated with Tn syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
- Versandbedingungen:
- Blue Ice