DIMT1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7589
Zusätzliche Namen:: DIM1|DIMT1|DIMT1L|HSA9761|HUSSY5
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Uniprot:: Q9UNQ2
Synonyme:: 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase;18S rRNA dimethylase;DIM1;DIM1 dimethyladenosine transferase 1 homolog;DIM1 dimethyladenosine transferase 1-like;dimethyladenosine transferase;DIMT1 rRNA methyltransferase and ribosome maturation factor;DIMT1L;HSA9761;HUSSY5;probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase;probable 18S rRNA dimethylase;probable dimethyladenosine transferase;probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase;S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase
Weitere Details:: The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus.

Versandbedingungen:: Blue Ice