A7581
WDR45 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7581
- Zusätzliche Namen:
- JM5|NBIA4|NBIA5|WDR45|WDRX1|WIPI-4|WIPI4
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 39kDa/35kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLC
- Uniprot:
- Q9Y484
- Synonyme:
- JM5;NBIA4;NBIA5;neurodegeneration with brain iron accumulation 4;neurodegeneration with brain iron accumulation 5;WD repeat domain phosphoinositide-interacting protein 4;WD repeat domain, X-linked 1;WD repeat-containing protein 45;WD45 repeat protein interacting with phosphoinositides 4;WDRX1;WIPI-4;WIPI4
- Weitere Details:
- This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene has a pseudogene at chromosome 4q31.3. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity and full-length nature of some variants have not been determined.
- Versandbedingungen:
- Blue Ice