A7568
CCL3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7568
- Zusätzliche Namen:
- CCL3|G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Uniprot:
- P10147
- Synonyme:
- C-C motif chemokine 3;G0/G1 switch regulatory protein 19-1;G0S19-1;LD78ALPHA;macrophage inflammatory protein 1-alpha;MIP-1-alpha;MIP1A;PAT 464.1;SCYA3;SIS-beta;small inducible cytokine A3 (homologous to mouse Mip-1a);Small-inducible cytokine A3;tonsillar lymphocyte LD78 alpha protein
- Weitere Details:
- This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
- Versandbedingungen:
- Blue Ice