Cytokeratin 6 (KRT6) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7560
Zusätzliche Namen:: CK-6C|CK-6E|CK6A|CK6C|CK6D|Cytokeratin 6 (KRT6)|K6A|K6C|K6D|KRT6C|KRT6D|PC3
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF
Uniprot:: P02538
Synonyme:: CK-6C;CK-6E;CK6A;CK6C;CK6D;cytokeratin 6A;cytokeratin 6C;cytokeratin 6D;Cytokeratin-6A;Cytokeratin-6D;K6A;K6C;K6D;keratin 6A, , type II;keratin 6A, type II;Keratin-6A;keratin, epidermal type II, K6A;keratin, type II cytoskeletal 6A;KRT6C;KRT6D;PC3;type-II keratin Kb6
Weitere Details:: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. In addition, peptides from the C-terminal region of the protein have antimicrobial activity against bacterial pathogens. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Versandbedingungen:: Blue Ice