A7557
HLA-G Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7557
- Zusätzliche Namen:
- HLA-G|MHC-G
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWAL
- Uniprot:
- P17693
- Synonyme:
- b2 microglobulin;HLA class I histocompatibility antigen, alpha chain G;HLA G antigen;HLA-G histocompatibility antigen, class I, G;MHC class I antigen G;MHC class Ib antigen;MHC-G;mutant MHC class I antigen;mutant MHC class Ib antigen
- Weitere Details:
- HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.
- Versandbedingungen:
- Blue Ice