A7549
CSRP2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7549
- Zusätzliche Namen:
- CRP2|CSRP2|LMO5|SmLIM
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26-30 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
- Uniprot:
- Q16527
- Synonyme:
- CRP2;cysteine and glycine-rich protein 2;cysteine-rich protein 2;epididymis secretory sperm binding protein;LIM domain only 5, smooth muscle;LIM domain only protein 5;LMO-5;LMO5;SmLIM;smooth muscle cell LIM protein
- Weitere Details:
- CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice