A7532
ELMOD3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7532
- Zusätzliche Namen:
- DFNA81|DFNB88|ELMOD3|LST3|RBED1|RBM29
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 38/43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ATFLHLAHVWRTQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFKDLTFTGESDLQSHSSEGVWLI
- Uniprot:
- Q96FG2
- Synonyme:
- deafness, autosomal recessive 88;DFNA81;DFNB88;ELMO domain-containing protein 3;ELMO/CED-12 domain containing 3;liver-specific organic anion transporter 3TM12;LST3;organic anion transporter LST-3b;RBED1;RBM29;RNA binding motif and ELMO/CED-12 domain 1;RNA-binding motif and ELMO domain-containing protein 1;RNA-binding motif protein 29;RNA-binding protein 29
- Weitere Details:
- This gene encodes a member of the engulfment and cell motility family of GTPase-activating proteins that regulate Arf GTPase proteins. Members of this family are defined by a conserved engulfment and cell motility domain. In rat cochlea, the encoded protein is found in stereocilia, kinocilia and cuticular plate of developing hair cells suggesting a function for this protein in cochlear sensory cells. An allelic variant of this family has been associated with autosomal recessive nonsyndromic deafness-88 in humans. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice