A7528
WIPI1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7528
- Zusätzliche Namen:
- ATG18|ATG18A|WIPI1|WIPI49
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 46kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS
- Uniprot:
- Q5MNZ9
- Synonyme:
- ATG18;atg18 protein homolog;ATG18A;WD repeat domain phosphoinositide-interacting protein 1;WD40 repeat protein interacting with phosphoinositides of 49 kDa;WIPI-1 alpha;WIPI49
- Weitere Details:
- This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice