ZNF24 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7500
Zusätzliche Namen:: KOX17|RSG-A|Zfp191|ZNF191|ZNF24|ZSCAN3
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV
Uniprot:: P17028
Synonyme:: KOX17;retinoic acid suppression protein A;RSG-A;Zfp191;zinc finger and SCAN domain-containing protein 3;zinc finger protein 191;zinc finger protein 24;zinc finger protein 24 (KOX 17);zinc finger protein KOX17;ZNF191;ZSCAN3
Weitere Details:: Enables DNA-binding transcription activator activity, RNA polymerase II-specific; identical protein binding activity; and sequence-specific DNA binding activity. Involved in negative regulation of transcription, DNA-templated and positive regulation of transcription by RNA polymerase II. Located in nucleoplasm.