PPP3R2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7495
Zusätzliche Namen:: PPP3R2|PPP3RL
Anwendung:: ELISA, WB
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Uniprot:: Q96LZ3
Synonyme:: calcineurin B-like protein;calcineurin B, type II (19kDa);calcineurin BII;calcineurin subunit B type 2;CBLP;CNBII;PPP3R1-like;PPP3RL;protein phosphatase 2B regulatory subunit 2;Protein phosphatase 3 regulatory subunit B beta isoform
Weitere Details:: Predicted to enable calcium ion binding activity and calcium-dependent protein serine/threonine phosphatase regulator activity. Predicted to be involved in regulation of catalytic activity. Predicted to act upstream of or within penetration of zona pellucida. Predicted to be located in sperm mitochondrial sheath. Predicted to be part of calcineurin complex.