Cytokeratin 16 (KRT16) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7493
Zusätzliche Namen:: CK16|Cytokeratin 16 (KRT16)|FNEPPK|K16|K1CP|KRT16A|NEPPK|PC1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLDELTLARTDLEMQIEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRLLEGEDAHLSS
Uniprot:: P08779
Synonyme:: CK16;cytokeratin 16;Cytokeratin-16;FNEPPK;focal non-epidermolytic palmoplantar keratoderma;K16;K1CP;keratin 16, type I;Keratin-16;keratin, type I cytoskeletal 16;KRT16A;NEPPK;PC1
Weitere Details:: The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.

Versandbedingungen:: Blue Ice