DAAM2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7463
Zusätzliche Namen:: DAAM2|dJ90A20A.1|NPHS24
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 123kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK
Uniprot:: Q86T65
Synonyme:: disheveled-associated activator of morphogenesis 2;dJ90A20A.1;NPHS24
Weitere Details:: Predicted to enable actin binding activity and small GTPase binding activity. Predicted to be involved in nervous system development and regulation of Wnt signaling pathway. Predicted to act upstream of or within determination of left/right symmetry. Located in extracellular exosome.