TEAD3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7454
Zusätzliche Namen:: DTEF-1|ETFR-1|TEAD-3|TEAD3|TEAD5|TEF-5|TEF5
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTIS
Uniprot:: Q99594
Synonyme:: DTEF-1;ETFR-1;TEA domain family member 3;TEA domain family member 5;TEAD-3;TEAD5;TEF-5;TEF5;transcriptional enhancer factor 5;transcriptional enhancer factor TEF-5;transcriptional enhancer factor TEF-5 (DTEF-1)
Weitere Details:: This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.