SHBG Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7450
Zusätzliche Namen:: ABP|SBP|SHBG|TEBG
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRI
Uniprot:: P04278
Synonyme:: ABP;SBP;sex hormone-binding globulin;sex steroid-binding protein;TEBG;testis-specific androgen-binding protein;testosterone-binding beta-globulin;testosterone-estradiol-binding globulin;testosterone-estrogen-binding globulin
Weitere Details:: This gene encodes a steroid binding protein that was first described as a plasma protein secreted by the liver but is now thought to participate in the regulation of steroid responses. The encoded protein transports androgens and estrogens in the blood, binding each steroid molecule as a dimer formed from identical or nearly identical monomers. Polymorphisms in this gene have been associated with polycystic ovary syndrome and type 2 diabetes mellitus. Alternative splicing results in multiple transcript variants.