A7449
SH3GL1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7449
- Zusätzliche Namen:
- CNSA1|EEN|SH3D2B|SH3GL1|SH3P8
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 41kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ
- Uniprot:
- Q99961
- Synonyme:
- CNSA1;EEN;EEN fusion partner of MLL;endophilin-2;endophilin-A2;extra 11-19 leukemia fusion;extra eleven-nineteen leukemia fusion gene protein;SH3 domain protein 2B;SH3 domain-containing GRB2-like protein 1;SH3-containing Grb-2-like 1 protein;SH3-domain GRB2-like 1;SH3D2B;SH3P8
- Weitere Details:
- This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice

