A7442
NDUFV2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7442
- Zusätzliche Namen:
- CI-24k|MC1DN7|NDUFV2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
- Uniprot:
- P19404
- Synonyme:
- CI-24k;complex I 24kDa subunit;complex I, mitochondrial respitory chain, 24 kD subunit;MC1DN7;NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa;NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial;NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial;NADH-ubiquinone oxidoreductase 24 kDa subunit;NADH-ubiquinone oxidoreductase flavoprotein 2;nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit
- Weitere Details:
- The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinson's disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19.
- Versandbedingungen:
- Blue Ice

