ZBTB48 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7435
Zusätzliche Namen:: HKR3|pp9964|TZAP|ZBTB48|ZNF855
Anwendung:: ELISA, WB
Molekulargewicht:: 76kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEP
Uniprot:: P10074
Synonyme:: GLI-Kruppel family member HKR3;HKR3;krueppel-related zinc finger protein 3;pp9964;telomere zinc finger-associated protein;telomeric zinc finger-associated protein;TZAP;zinc finger and BTB domain-containing protein 48;zinc finger protein 855;ZNF855
Weitere Details:: Enables double-stranded telomeric DNA binding activity; identical protein binding activity; and transcription cis-regulatory region binding activity. Involved in positive regulation of transcription, DNA-templated and telomere maintenance via telomere lengthening. Located in chromosome, telomeric region.