GSDME (Full length+N terminal)Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7432
Zusätzliche Namen:: DFNA5|GSDME|ICERE-1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 30 kDa/55 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD
Uniprot:: O60443
Synonyme:: DFNA5;DFNA5, deafness associated tumor suppressor;gasdermin-E;ICERE-1;inversely correlated with estrogen receptor expression 1;non-syndromic hearing impairment protein 5;nonsyndromic hearing impairment protein
Weitere Details:: Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.