SIRT6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7416
Zusätzliche Namen:: 2810449N18Rik|mSIRT6|Sir2l6|SIRT6
Anwendung:: ELISA, WB
Molekulargewicht:: 36-42 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
Uniprot:: Q8N6T7
Synonyme:: 2810449N18Rik;AI043036;NAD-dependent deacetylase sirtuin-6;NAD-dependent protein deacetylase sirtuin-6;regulatory protein SIR2 homolog 6;SIR2-like protein 6;sir2-related protein type 6;Sir2l6;sirtuin type 6
Weitere Details:: Enables several functions, including NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); and transcription corepressor activity. Involved in several processes, including cellular protein modification process; negative regulation of nucleobase-containing compound metabolic process; and positive regulation of cell population proliferation. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; gonad; musculature; and retina. Used to study progeria. Orthologous to human SIRT6 (sirtuin 6).