ORAI1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7412
Zusätzliche Namen:: CRACM1|IMD9|ORAI1|ORAT1|TAM2|TMEM142A
Anwendung:: ELISA, WB
Molekulargewicht:: 32-55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFA
Uniprot:: Q96D31
Synonyme:: calcium release-activated calcium channel protein 1;calcium release-activated calcium modulator 1;CRACM1;IMD9;ORAT1;protein orai-1;TAM2;TMEM142A;transmembrane protein 142A
Weitere Details:: The protein encoded by this gene is a membrane calcium channel subunit that is activated by the calcium sensor STIM1 when calcium stores are depleted. This type of channel is the primary way for calcium influx into T-cells. Defects in this gene are a cause of immune dysfunction with T-cell inactivation due to calcium entry defect type 1 (IDTICED1).