ATG4C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7396
Zusätzliche Namen:: APG4-C|APG4C|ATG4C|AUTL1|AUTL3|HsAPG4C
Anwendung:: ELISA, WB
Molekulargewicht:: 52kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKI
Uniprot:: Q96DT6
Synonyme:: APG4 autophagy 4 homolog C;APG4-C;APG4C;ATG4 autophagy related 4 homolog C;AUT-like 1, cysteine endopeptidase;AUT-like 3 cysteine endopeptidase;AUTL1;AUTL3;autophagin-3;autophagy-related cysteine endopeptidase 3;autophagy-related protein 4 homolog C;cysteine protease ATG4C;epididymis secretory sperm binding protein
Weitere Details:: Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding the same protein, have been characterized.

Versandbedingungen:: Blue Ice