A7390
ATG10 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7390
- Zusätzliche Namen:
- APG10|APG10L|ATG10|pp12616
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
- Uniprot:
- Q9H0Y0
- Synonyme:
- APG10;APG10 autophagy 10-like;APG10L;ATG10 autophagy related 10 homolog;autophagy-related protein 10;pp12616;ubiquitin-like-conjugating enzyme ATG10
- Weitere Details:
- Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).
- Versandbedingungen:
- Blue Ice