NLRC4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7382
Zusätzliche Namen:: AIFEC|CARD12|CLAN|CLAN1|CLANA|CLANB|CLANC|CLAND|CLR2.1|FCAS4|IPAF|NLRC4
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 116 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGE
Uniprot:: Q9NPP4
Synonyme:: AIFEC;CARD, LRR, and NACHT-containing protein;CARD12;caspase recruitment domain family, member 12;caspase recruitment domain-containing protein 12;CED-4-like protein Clan;CLAN;CLAN1;CLANA;CLANB;CLANC;CLAND;CLR2.1;FCAS4;Ice protease-activating factor;ICE-protease activating factor;IPAF;NLR family CARD domain-containing protein 4;NOD-like receptor C4;nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4
Weitere Details:: This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants.