A7380
CSRP2BP Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7380
- Zusätzliche Namen:
- ATAC2|CRP2BP|CSRP2BP|dJ717M23.1|PRO1194
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DGIYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLHRSDPHWTPEPDAPLDYCYVRPNHIPTINSMCQEFFWPGIDLSECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAYISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLHVSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLESTECKHAFFLRLRR
- Uniprot:
- Q9H8E8
- Synonyme:
- ADA2A-containing complex subunit 2;ATAC component 2 homolog;ATAC2;CRP2 binding partner;CRP2 binding protein;CRP2-binding partner;CRP2BP;CSRP2-binding protein;CSRP2BP;cysteine-rich protein 2-binding protein;dJ717M23.1;Lysine acetyltransferase 14;PRO1194
- Weitere Details:
- CSRP2 is a protein containing two LIM domains, which are double zinc finger motifs found in proteins of diverse function. CSRP2 and some related proteins are thought to act as protein adapters, bridging two or more proteins to form a larger protein complex. The protein encoded by this gene binds to one of the LIM domains of CSRP2 and contains an acetyltransferase domain. Although the encoded protein has been detected in the cytoplasm, it is predominantly a nuclear protein. Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice