A7376
DCP1A Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7376
- Zusätzliche Namen:
- DCP1A|HSA275986|Nbla00360|SMAD4IP1|SMIF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 70kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- ABP:
- No Import Docs
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
- Uniprot:
- Q9NPI6
- Synonyme:
- DCP1 decapping enzyme homolog A;DCP1 decapping enzyme-like protein A;decapping enzyme hDcp1a;HSA275986;mRNA-decapping enzyme 1A;Nbla00360;putative protein product of Nbla00360;Smad4-interacting transcriptional co-activator;SMAD4IP1;SMIF;transcription factor SMIF
- Weitere Details:
- Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice