SUPT20H Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7374
Zusätzliche Namen:: C13|C13orf19|FAM48A|FP757|P38IP|SPT20|SUPT20H
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 86kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLSGLLPSGGLLPNALPSAMQAASQAGVPFGLKNTSSLRPLNLLQLPGGSLIFNTLQQQQQQLSQFTPQQPQQPTTCSPQQPGEQGSEQGSTSQEQALSAQQAAVINLTGVGSFMQSQAAVLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQIQQLRFLQHQMAMAAAAAQTAQLHHHRHTGSQSKSKMKRGTPTTPKF
Uniprot:: Q8NEM7
Synonyme:: C13;C13orf19;FAM48A;family with sequence similarity 48, member A;FP757;p38-interacting protein;P38IP;protein FAM48A;SPT20;suppressor of Ty 20 homolog;transcription factor (p38 interacting protein);transcription factor SPT20 homolog;tumor rejection antigen
Weitere Details:: Predicted to enable transcription coregulator activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of gluconeogenesis and positive regulation of transcription by RNA polymerase II. Part of SAGA-type complex.