UBE2R2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7373
Zusätzliche Namen:: CDC34B|E2-CDC34B|UBC3B|UBE2R2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Uniprot:: Q712K3
Synonyme:: CDC34B;E2 ubiquitin-conjugating enzyme R2;E2-CDC34B;UBC3B;ubiquitin carrier protein R2;ubiquitin conjugating enzyme E2R 2;ubiquitin-conjugating enzyme E2 R2;ubiquitin-conjugating enzyme E2-CDC34B;ubiquitin-conjugating enzyme UBC3B;ubiquitin-protein ligase R2
Weitere Details:: Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation.