CARD10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7368
Zusätzliche Namen:: BIMP1|CARD10|CARMA3|IMD89
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 116kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVECGSSRGCPSSSEA
Uniprot:: Q9BWT7
Synonyme:: Bcl10 binding protein and activator of NFKB;BIMP1;CARD-containing MAGUK 3 protein;CARD-containing MAGUK protein 3;carma 3;CARMA3;caspase recruitment domain-containing protein 10
Weitere Details:: The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10 belongs to the membrane-associated guanylate kinase (MAGUK) family and activates NF-kappa-B (NFKB; see MIM 164011) through BCL10 (MIM 603517) (Wang et al., 2001 [PubMed 11259443]).