ARHGAP44 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7357
Zusätzliche Namen:: ARHGAP44|NPC-A-10|RICH2
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST
Uniprot:: Q17R89
Synonyme:: NPC-A-10;rho GTPase-activating protein 44;rho GTPase-activating protein RICH2;Rho-type GTPase-activating protein RICH2;RhoGAP interacting with CIP4 homologs protein 2;RICH2
Weitere Details:: Enables phospholipid binding activity. Predicted to be involved in several processes, including modification of dendritic spine; negative regulation of Rac protein signal transduction; and regulation of plasma membrane bounded cell projection organization. Located in leading edge membrane.