UBE2H Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7344
Zusätzliche Namen:: E2-20K|GID3|UBC8|UBCH|UBCH2|UBE2H
Anwendung:: ELISA, WB
Molekulargewicht:: 21-42kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Uniprot:: P62256
Synonyme:: (E3-independent) E2 ubiquitin-conjugating enzyme H;E2 ubiquitin-conjugating enzyme H;E2-20K;GID complex subunit 3, UBC8 homolog;GID3;UBC8;UBCH;UBCH2;ubiquitin carrier protein H;ubiquitin conjugating enzyme E2H;ubiquitin-conjugating enzyme E2 H;ubiquitin-conjugating enzyme E2-20K;ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8);ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast);ubiquitin-protein ligase H
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms.

Versandbedingungen:: Blue Ice