[KO Validated] AMPKA Alpha2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A7339
Zusätzliche Namen:: AMPK|AMPK2|AMPKa2|PRKAA|A Alpha2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA
Uniprot:: P54646
Synonyme:: 5'-AMP-activated protein kinase catalytic subunit alpha-2;5'-AMP-activated protein kinase, catalytic alpha-2 chain;ACACA kinase;acetyl-CoA carboxylase kinase;AMP-activated protein kinase alpha-2 subunit variant 2;AMP-activated protein kinase alpha-2 subunit variant 3;AMPK;AMPK alpha 2;AMPK subunit alpha-2;AMPK-alpha-2 chain;AMPK2;AMPKa2;HMGCR kinase;hydroxymethylglutaryl-CoA reductase kinase;PRKAA;protein kinase, AMP-activated, alpha 2 catalytic subunit
Weitere Details:: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia.

Versandbedingungen:: Blue Ice