A7328
EPHA1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7328
- Zusätzliche Namen:
- EPH|EPHA1|EPHT|EPHT1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNGTPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRGLYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGT
- Uniprot:
- P21709
- Synonyme:
- EPH;EPH tyrosine kinase;eph tyrosine kinase 1;ephrin type-A receptor 1;EPHT;EPHT1;erythropoietin-producing hepatoma amplified sequence;erythropoietin-producing hepatoma receptor;hEpha1;oncogene EPH;soluble EPHA1 variant 1;soluble EPHA1 variant 2;tyrosine-protein kinase receptor EPH
- Weitere Details:
- This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis.
- Versandbedingungen:
- Blue Ice