SGTA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7306
Zusätzliche Namen:: alphaSGT|hSGT|SGT|SGT1|SGTA|Vpu
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
Uniprot:: O43765
Synonyme:: alpha-SGT;alphaSGT;hSGT;protein containing three tetratricopeptide repeats;SGT;SGT1;small glutamine rich tetratricopeptide repeat containing alpha;small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha;small glutamine-rich tetratricopeptide repeat-containing protein alpha;UBP;viral protein U-binding protein;Vpu;vpu-binding protein
Weitere Details:: This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 70-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function.