A7293
NCBP2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A7293
- Zusätzliche Namen:
- CBC2|CBP20|NCBP2|NIP1|PIG55
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
- Uniprot:
- P52298
- Synonyme:
- 20 kDa nuclear cap-binding protein;CBC2;CBP20;cell proliferation-inducing gene 55 protein;NCBP 20 kDa subunit;NCBP interacting protein 1;NCBP-interacting protein 1;NIP1;nuclear cap binding protein subunit 2, 20kD;nuclear cap binding protein subunit 2, 20kDa;nuclear cap-binding protein subunit 2;PIG55
- Weitere Details:
- The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice