UIMC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7244
Zusätzliche Namen:: RAP80|UIMC1|X2HRIP110
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 120kDa/100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDS
Uniprot:: Q96RL1
Synonyme:: BRCA1-A complex subunit RAP80;RAP80;receptor-associated protein 80;retinoid X receptor-interacting protein 110;Ubiquitin interaction motif-containing protein 1;X2HRIP110
Weitere Details:: This gene encodes a nuclear protein that interacts with Brca1 (breast cancer 1) in a complex to recognize and repair DNA lesions. This protein binds ubiquitinated lysine 63 of histone H2A and H2AX. This protein may also function as a repressor of transcription. Alternative splicing results in multiple transcript variants.