THRSP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7232
Zusätzliche Namen:: Lpgp|LPGP1|S14|SPOT14|THRP|THRSP
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
Uniprot:: Q92748
Synonyme:: lipogenic protein 1;Lpgp;LPGP1;S14;spot 14 protein;SPOT14;SPOT14 homolog;THRP;thyroid hormone responsive (SPOT14 homolog, rat);thyroid hormone-inducible hepatic protein
Weitere Details:: The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism.