MOV10 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A7227
Zusätzliche Namen:: fSAP113|gb110|MOV10
Anwendung:: ELISA, WB
Molekulargewicht:: 114kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLK
Uniprot:: Q9HCE1
Synonyme:: armitage homolog;fSAP113;functional spliceosome-associated protein 113;gb110;helicase MOV-10;moloney leukemia virus 10 protein;Mov10, Moloney leukemia virus 10, homolog;putative helicase MOV-10
Weitere Details:: Enables 5'-3' RNA helicase activity and RNA binding activity. Involved in defense response to virus; negative regulation of transposition, RNA-mediated; and posttranscriptional regulation of gene expression. Located in P-body and cytosol. Implicated in hypertension.