TOB2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7223
Zusätzliche Namen:: APRO5|TOB2|TOB4|TOBL|TROB2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVEL
Uniprot:: Q14106
Synonyme:: APRO5;protein Tob2;protein Tob4;TOB4;TOBL;transducer of erbB-2 2;TROB2
Weitere Details:: TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.