A7221
TAF5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A7221
- Zusätzliche Namen:
- TAF(II)100|TAF2D|TAF5|TAFII-100|TAFII100
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
- Uniprot:
- Q15542
- Synonyme:
- TAF(II)100;TAF2D;TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa;TAFII-100;TAFII100;TATA box binding protein (TBP)-associated factor 2D;TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD;transcription initiation factor TFIID 100 kD subunit;transcription initiation factor TFIID 100 kDa subunit;transcription initiation factor TFIID subunit 5
- Weitere Details:
- Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes an integral subunit of TFIID associated with all transcriptionally competent forms of that complex. This subunit interacts strongly with two TFIID subunits that show similarity to histones H3 and H4, and it may participate in forming a nucleosome-like core in the TFIID complex. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice



