ELF5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7181
Zusätzliche Namen:: ELF5|ESE2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 31kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
ABP:: No Import Docs
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSN
Uniprot:: Q9UKW6
Synonyme:: E74-like factor 5;E74-like factor 5 (ets domain transcription factor);epithelium-restricted ESE-1-related Ets factor;epithelium-specific Ets transcription factor 2;ESE2;ETS-related transcription factor Elf-5
Weitere Details:: This gene encodes an epithelium-specific ETS family transcription factor. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. This gene has been implicated as a tumor suppressive transcription factor in breast cancer.