CRISP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A7177
Zusätzliche Namen:: CRISP-2|CRISP2|CT36|GAPDL5|TPX1|TSP1
Anwendung:: ELISA, WB
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
Uniprot:: P16562
Synonyme:: cancer/testis antigen 36;CRISP-2;CT36;cysteine-rich secretory protein 2;GAPDL5;glyceraldehyde-3-phosphate dehydrogenase-like 5;testicular tissue protein Li 43;testis specific protein 1 (probe H4-1 p3-1);testis-specific protein TPX-1;TPX1;TSP1
Weitere Details:: Predicted to be involved in cell-cell adhesion. Predicted to be active in extracellular space.